missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FLT1 D3 Protein

Product Code. 15994408
Click to view available options
Quantity:
10 μg
100 μg
2 μg
Unit Size:
100µg
10µg
2µg
This item is not returnable. View return policy

Product Code. 15994408

Brand: enQuireBio™ QP106122ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the FLT1 D3 was constructed and used to recombinantly synthesize the protein.

Specifications

Gene ID (Entrez) 2321
Name FLT1 D3 Protein
Quantity 2 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Gene Symbol FLT1
Biological Activity The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Product Type Recombinant Protein
Cross Reactivity Human
Species Baculovirus
Protein Tag Untagged
Sequence SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
Buffer FLT1 D1-3 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS.
Purity or Quality Grade Greater than 90.0% as determined by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.