missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human GNLY Protein

A cDNA sequence encoding the GNLY was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12021-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15939118

  • € 181.00 / 10µg

Estimated Shipment: 03-02-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

GNLY Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers