missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PON2 Protein

A cDNA sequence encoding the PON2 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13110-2ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15932539

  • € 120.00 / 2µg

Estimated Shipment: 03-02-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

PON2 Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
PON2 is supplied in PBS and 50% glycerol.
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Research Use Only
Recombinant Protein
E. coli
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers