missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PRL R Protein

Product Code. 15945348
Click to view available options
Quantity:
1 mg
20 μg
5 μg
Unit Size:
1mg
20µg
5µg
This item is not returnable. View return policy

Product Code. 15945348

Brand: enQuireBio™ QP108465ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.

Specifications

Name PRL R Protein
Quantity 5 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Biological Activity Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Product Type Recombinant Protein
Cross Reactivity Human
Species E. coli
Protein Tag Untagged
Sequence AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Buffer The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.
Purity or Quality Grade Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.