missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SYK Protein

A cDNA sequence encoding the SYK was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13656-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15944289

  • € 181.00 / 10µg

Estimated Shipment: 03-02-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

6850
Greater than 85.0% as determined by SDS-PAGE.
Research Use Only
SYK
Human
Flag Tag
SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
SYK Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers