missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Rabbit GHBP Protein

enQuireBio™ Recombinant Rabbit GHBP Protein

Product Code. 15954498
Click to view available options
Quantity:
1 mg
20 μg
5 μg
Unit Size:
1mg
20µg
5µg
This item is not returnable. View return policy

Product Code. 15954498

Brand: enQuireBio™ QP1064220ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

Specifications

Name GHBP Protein
Quantity 20 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Biological Activity Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Product Type Recombinant Protein
Cross Reactivity Rabbit
Species E. coli
Protein Tag Untagged
Sequence AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Buffer The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Purity or Quality Grade Greater than 98.0% as determined bySDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.