missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant SARS SARS MERS Protein

A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13419-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15933509

  • € 800.00 / 500µg

Estimated Shipment: 30-01-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

SARS SARS MERS Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
SARS
His
SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Videos
SDS
Documents
Certificates
Special Offers

Special Offers