missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Renin R Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94053-0.1ml
This item is not returnable.
View return policy
Description
Renin R Polyclonal antibody specifically detects Renin R in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Renin R | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| APT6M8-9, ATP6M8-9MRXE, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase, H+ transporting, lysosomal accessory protein 2, ATPase, H+ transporting, lysosomal interacting protein 2, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER-localized type I transmembrane adaptor, H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9, M8-9, MGC99577, MSTP009, N14F, renin receptor, vacuolar proton ATP synthase membrane sector associated protein M8-9, V-ATPase M8.9 subunit, XMRE | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2). MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 10159 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction