missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REV3L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | REV3L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18229461
|
Novus Biologicals
NBP2-57595 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695776
|
Novus Biologicals
NBP2-57595-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
REV3L Polyclonal specifically detects REV3L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| REV3L | |
| Polyclonal | |
| Rabbit | |
| DNA Polymerases, DNA Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5980 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.7, EC 2.7.7.7, hREV3, Protein reversionless 3-like, REV3 (yeast homolog)-like, catalytic subunit of DNA polymerase zeta, REV3-like, REV3-like, catalytic subunit of DNA polymerase zeta (yeast), yeast, homolog-like (polymerase, DNA, zeta) | |
| REV3L | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title