missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RGPD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46773-25ul
This item is not returnable.
View return policy
Description
RGPD1 Polyclonal antibody specifically detects RGPD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| RGPD1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Ran-Binding Protein 2-Like 2/6, Ran-Binding Protein 2-Like 6, RANBP2L2, RANBP2L6, RanBP2-Like 2/6, RanBP2-Like 6, RANBP2-Like And GRIP Domain Containing 1, RANBP2-Like And GRIP Domain-Containing Protein 1/2, RGP1, RGPD2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTP | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 400966 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur