missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RGPD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46773-25ul
This item is not returnable.
View return policy
Description
RGPD1 Polyclonal antibody specifically detects RGPD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| RGPD1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Ran-Binding Protein 2-Like 2/6, Ran-Binding Protein 2-Like 6, RANBP2L2, RANBP2L6, RanBP2-Like 2/6, RanBP2-Like 6, RANBP2-Like And GRIP Domain Containing 1, RANBP2-Like And GRIP Domain-Containing Protein 1/2, RGP1, RGPD2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTP | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 400966 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction