missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RHCG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | RHCG |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18478861
|
Novus Biologicals
NBP2-30825-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18176072
|
Novus Biologicals
NBP2-30825 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RHCG Polyclonal specifically detects RHCG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RHCG | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ammonium transporter Rh type C, CDRC2, chromosome 15 open reading frame 6, PDRC2C15orf6, Rh family type C glycoprotein, Rh family, C glycoprotein, Rh glycoprotein kidney, Rh type C glycoprotein, Rhesus blood group family type C glycoprotein, Rhesus blood group, C glycoprotein, RHGKTumor-related protein DRC2, SLC42A3 | |
| RHCG | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9UBD6 | |
| 51458 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title