missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RHEBL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33674-25ul
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
RHEBL1 Polyclonal specifically detects RHEBL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
| RHEBL1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q8TAI7 | |
| RHEBL1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLV | |
| 25 μL | |
| Signal Transduction | |
| 121268 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ25797, GTPase RhebL1, MGC34869, Ras homolog enriched in brain like 1, Ras homolog enriched in brain like 1 c, Ras homolog enriched in brain like-1 c, Ras homolog enriched in brain-like protein 1, Rheb2, RHEBL1c, Rheb-like protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion