missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RhoB Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 231.00 - € 468.00
Specifications
| Antigen | RhoB |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunoprecipitation 1:50-1:100 |
| Applications | Western Blot, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RhoB Polyclonal antibody specifically detects RhoB in Mouse samples. It is validated for Western Blot, ImmunoprecipitationSpecifications
| RhoB | |
| Western Blot, Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis | |
| PBS (pH 7.3), 50% glycerol | |
| 388 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunoprecipitation 1:50-1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB | |
| A synthetic peptide corresponding to a sequence within amino acids 100-196 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title