missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RIC8A Antibody (1H6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00060626-M01-100ug
This item is not returnable.
View return policy
Description
RIC8A Monoclonal antibody specifically detects RIC8A in Human samples. It is validated for Western Blot, ELISA
Specifications
| RIC8A | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| RIC8, RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans), synembryn, synembryn-A | |
| RIC8A (NP_068751.4, 462 a.a. ∽ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 1H6 | |
| Western Blot, ELISA | |
| NP_068751.4 | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| 60626 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction