missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RICS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | RICS |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18669875
|
Novus Biologicals
NBP2-38926-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18151669
|
Novus Biologicals
NBP2-38926 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RICS Polyclonal specifically detects RICS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RICS | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| brain-specific Rho GTP-ase-activating protein, Brain-specific Rho GTPase-activating protein, GAB-associated CDC42, GAB-associated Cdc42/Rac GTPase-activating protein, GC-GAPGTPase regulator interacting with TrkA, GRITp200RhoGAP, KIAA0712p250GAP, MGC1892, rac GTPase activating protein, Rho GTPase activating protein 32, rho GTPase-activating protein 32, Rho/Cdc42/Rac GTPase-activating protein RICS, RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling, RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling, Rho-type GTPase-activating protein 32, RICSPX-RICS | |
| ARHGAP32 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| A7KAX9 | |
| 9743 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PNDHNVVSMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title