missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RND1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35379-20ul
This item is not returnable.
View return policy
Description
RND1 Polyclonal antibody specifically detects RND1 in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| RND1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| ARHS, GTP-binding protein, ras homolog gene family, member S, Rho family GTPase 1FLJ42294, Rho6, rho-related GTP-binding protein Rho6, RHOS, Rnd1 | |
| A synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1).,, Sequence:, EQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM | |
| 20 μL | |
| Signal Transduction | |
| 27289 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction