missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF123 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 468.00
Specifications
| Antigen | RNF123 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RNF123 Polyclonal antibody specifically detects RNF123 in Human, Mouse samples. It is validated for Western BlotSpecifications
| RNF123 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.3), 50% glycerol | |
| 63891 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| DKFZp686C2222, E3 ubiquitin-protein ligase RNF123, EC 6.3.2.-, FLJ12565, Kip1 ubiquitination-promoting complex protein 1, KPC1, ring finger protein 123MGC163504, ubiquitin ligase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2). QSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title