missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF166 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 468.00
Specifications
| Antigen | RNF166 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RNF166 Polyclonal antibody specifically detects RNF166 in Human, Mouse samples. It is validated for Western BlotSpecifications
| RNF166 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.3), 50% glycerol | |
| 115992 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| MGC14381, MGC2647, ring finger protein 166 | |
| A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RNF166 (NP_849163.1). NKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title