missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF186 Antibody (4F10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00054546-M01
This item is not returnable.
View return policy
Description
RNF186 Monoclonal antibody specifically detects RNF186 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Frozen)
Specifications
| RNF186 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| FLJ20225, ring finger protein 186, RP11-91K11.1 | |
| RNF186 (NP_061935, 75 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Frozen) | |
| 4F10 | |
| Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Frozen | |
| NP_061935 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 54546 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction