Learn More
Abnova™ RNF8 Recombinant Protein
Description
The protein encoded by this gene contains a RING finger motif and a FHA domain. This protein has been shown to interact with several class II ubiquitin-conjugating enzymes (E2), including UBE2E1/UBCH6, UBE2E2, and UBE2E3, and may act as an ubiquitin ligase (E3) in the ubiquitination of certain nuclear proteins. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Theoretical MW (kDa): 79.09
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Specifications
| Accession Number | AAH07517 |
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gene ID (Entrez) | 9025 |
| Molecular Weight (g/mol) | 79.09 |
| Name | RNF8 (Human) Recombinant Protein (P01) |
| pH Range | 8 |
| Preparation Method | In vitro wheat germ expression system |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.