missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ROR alpha/NR1F1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 513.00
Specifications
| Antigen | ROR alpha/NR1F1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Host Species | Rabbit |
Description
ROR alpha/NR1F1 Polyclonal specifically detects ROR alpha/NR1F1 in Human, Rat samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.Specifications
| ROR alpha/NR1F1 | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| DKFZp686M2414, MGC119326, NR1F1MGC119329, nuclear receptor ROR-alpha, Nuclear receptor RZR-alpha, Nuclear receptor subfamily 1 group F member 1, RAR-related orphan receptor A, RAR-related orphan receptor alpha, retinoic acid receptor-related orphan receptor alpha, retinoid-related orphan receptor alpha, Retinoid-related orphan receptor-alpha, ROR1, ROR2, ROR3, RZR-ALPHA, RZRAROR-alpha, transcription factor RZR-alpha | |
| RORA | |
| IgG | |
| Protein A purified |
| Polyclonal | |
| Purified | |
| RUO | |
| P35398 | |
| 6095 | |
| Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. | |
| Primary | |
| 63 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title