missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL35A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93083-0.1ml
This item is not returnable.
View return policy
Description
RPL35A Polyclonal antibody specifically detects RPL35A in Mouse, Rat samples. It is validated for Western Blot
Specifications
| RPL35A | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Cell growth-inhibiting gene 33 protein, DBA5,60S ribosomal protein L35a, ribosomal protein L35a | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2). IFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRS | |
| 0.1 mL | |
| DNA replication Transcription Translation and Splicing | |
| 6165 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction