missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL36AL Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 470.00
Specifications
| Antigen | RPL36AL |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18623271
|
Novus Biologicals
NBP2-93339-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18609650
|
Novus Biologicals
NBP2-93339-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPL36AL Polyclonal antibody specifically detects RPL36AL in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| RPL36AL | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| 60S ribosomal protein L36a-like, MGC111574, ribosomal protein HL44,60S ribosomal protein L36a, ribosomal protein L36a, ribosomal protein L36a-like, RPL36A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1). MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6166 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title