missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPL7A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | RPL7A |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18464372
|
Novus Biologicals
NBP2-13258 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18434092
|
Novus Biologicals
NBP2-13258-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPL7A Polyclonal antibody specifically detects RPL7A in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| RPL7A | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6130 | |
| IgG | |
| Immunogen affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 60S ribosomal protein L7a, PLA-X polypeptide, ribosomal protein L7a, SURF-3, SURF3surfeit 3, Surfeit locus protein 3, thyroid hormone receptor uncoupling protein, TRUP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title