missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPS19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68805-25ul
This item is not returnable.
View return policy
Beskrivning
RPS19 Polyclonal antibody specifically detects RPS19 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifikationer
| RPS19 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| DBADBA1,40S ribosomal protein S19, ribosomal protein S19 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6223 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering