missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals RSK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89647
This item is not returnable.
View return policy
Description
RSK1 Polyclonal antibody specifically detects RSK1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| RSK1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| 90kD, polypeptide 1), EC 2.7.11, EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1, HU-1, MAP kinase-activated protein kinase 1a, MAPK-activated protein kinase 1a, MAPKAP kinase 1a, MAPKAPK-1a, p90RSK1, p90S6K, ribosomal protein S6 kinase alpha 1, ribosomal protein S6 kinase alpha-1, ribosomal protein S6 kinase, 90kD, polypeptide 1, ribosomal protein S6 kinase, 90kDa, polypeptide 1, Ribosomal S6 kinase 1, RSK, RSK-1, RSK1p90-RSK 1, S6K-alpha 1, S6K-alpha-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL | |
| 0.1 mL | |
| MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction | |
| 6195 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction