missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RTF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35771-100ul
This item is not returnable.
View return policy
Description
RTF1 Polyclonal antibody specifically detects RTF1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| RTF1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| KIAA0252GTL7, ortholog of mouse gene trap locus 7, RNA polymerase-associated protein RTF1 homolog, Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human RTF1 (NP_055953.3).,, Sequence:, LAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVY | |
| 100 μL | |
| Cell Cycle and Replication | |
| 23168 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction