missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S100A6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Brand: Novus Biologicals NBP1-89388
This item is not returnable.
View return policy
Description
S100A6 Polyclonal specifically detects S100A6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| S100A6 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| S100A6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research | |
| 6277 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.1mg/mL | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| 2A9, CABP, CACY5B10, calcyclin, Growth factor-inducible protein 2A9, MLN 4, PRAS100 calcium binding protein A6 (calcyclin), Prolactin receptor-associated protein, protein S100-A6, S100 calcium binding protein A6, S100 calcium-binding protein A6, S100 calcium-binding protein A6 (calcyclin) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human S100A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction