missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Salivary Amylase Alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46714
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
Salivary Amylase Alpha Polyclonal antibody specifically detects Salivary Amylase Alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Tekniske data
| Salivary Amylase Alpha | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P04745 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 276 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A, salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion