missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Salivary Amylase Alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46713
This item is not returnable.
View return policy
Description
Salivary Amylase Alpha Polyclonal antibody specifically detects Salivary Amylase Alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Salivary Amylase Alpha | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P04745 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 276 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A, salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction