missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAMD4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49440
This item is not returnable.
View return policy
Description
SAMD4A Polyclonal antibody specifically detects SAMD4A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| SAMD4A | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| DKFZp434H0350, DKFZp686A1532, hSmaug1DKFZP434H0350, KIAA1053SMAUG1, protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4, Smaug, Smaug 1, smaug homolog, Smaug1, SMG, SMGA, sterile alpha motif domain containing 4, sterile alpha motif domain containing 4A, Sterile alpha motif domain-containing protein 4A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 23034 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction