missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAP130 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92362-25ul
This item is not returnable.
View return policy
Description
SAP130 Polyclonal antibody specifically detects SAP130 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SAP130 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| KIAA0017splicing factor 3b, subunit 3, 130kD, Pre-mRNA-splicing factor SF3b 130 kDa subunit, RSE1, SAP130SAP 130, SF3B130, SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit, Spliceosome-associated protein 130, splicing factor 3B subunit 3, splicing factor 3b, subunit 3, 130kDa, STAF130 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFC | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 23450 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur