missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SARS Nucleocapsid Protein Antibody (AP201054), mFluor Violet 500 SE, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-90967MFV500
This item is not returnable.
View return policy
Description
SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA
Specifications
| SARS Nucleocapsid Protein | |
| Monoclonal | |
| mFluor Violet 500 SE | |
| 50mM Sodium Borate | |
| Mouse | |
| Protein G purified | |
| RUO | |
| Primary | |
| SARS-CoV, SARS-CoV-2 | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry, Immunoassay, Direct ELISA | |
| AP201054 | |
| Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA | |
| N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome | |
| The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 1489678 | |
| Store at 4C in the dark. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction