missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SART1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 572.00
Specifications
| Antigen | SART1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18462161
|
Novus Biologicals
NBP1-89023-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18717493
|
Novus Biologicals
NBP1-89023 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SART1 Polyclonal specifically detects SART1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SART1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9092 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| Allergen Hom s 1, Ara1, HAF, HOMS1, hSART-1, hSnu66, hypoxia-associated factor, IgE autoantigen, MGC2038, SART-1, SART1(259) protein, SART1(800) protein, SART1259, small nuclear ribonucleoprotein 110kDa (U4/U6.U5), SNRNP110, Snu66, SNU66 homolog, squamous cell carcinoma antigen recognised by T cells, squamous cell carcinoma antigen recognized by T cells, Squamous cell carcinoma antigen recognized by T cells 1, U4/U6.U5 tri-snRNP-associated 110 kDa protein, U4/U6.U5 tri-snRNP-associated protein 1 | |
| SART1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title