missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SBF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 590.10
Specifications
| Antigen | SBF2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18487721
|
Novus Biologicals
NBP2-13283-25ul |
25ul |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18740624
|
Novus Biologicals
NBP2-13283 |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
SBF2 Polyclonal specifically detects SBF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SBF2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 81846 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NQAPEKWQQLWERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSNGVERR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Charcot-Marie-Tooth neuropathy 4B2 (autosomal recessive, with myelinoutfolding), CMT4B2myotubularin related 13, DKFZp779B2327, KIAA1766FLJ41627, MTMR13FLJ22918, myotubularin-related protein 13, SET binding factor 2, SET-binding factor 2 | |
| SBF2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title