missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCD5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Especificaciones
| Antigen | SCD5 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Quantity | Precio | Cantidad y disponibilidad | |||||
|
18484481
|
Novus Biologicals
NBP1-89274-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18710234
|
Novus Biologicals
NBP1-89274 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
SCD5 Polyclonal specifically detects SCD5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| SCD5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79966 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ACOD4Acyl-CoA-desaturase 4, FADS4, FLJ21032, HSCD5Stearoyl-CoA 9-desaturase, SCD2, SCD4EC 1.14.19.1, stearoyl-CoA desaturase 4, stearoyl-CoA desaturase 5 | |
| SCD5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto