missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCML4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | SCML4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SCML4 Polyclonal specifically detects SCML4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SCML4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| dJ47M23.1, FLJ36252, sex comb on midleg-like 4 (Drosophila), sex comb on midleg-like protein 4 | |
| SCML4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 256380 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title