missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCN3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | SCN3B |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677818
|
Novus Biologicals
NBP2-68642-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18665206
|
Novus Biologicals
NBP2-68642 |
100 μg |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCN3B Polyclonal antibody specifically detects SCN3B in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| SCN3B | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 55800 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| HSA243396, KIAA1158, SCNB3, sodium channel subunit beta-3, sodium channel, voltage-gated, type III, beta, voltage-gated sodium channel beta-3 subunit | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title