missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SDF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62577
This item is not returnable.
View return policy
Description
SDF4 Polyclonal antibody specifically detects SDF4 in Human samples. It is validated for Western Blot
Specifications
| SDF4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| 45 kDa calcium-binding protein, CAB45, Cab45Stromal cell-derived factor 4, calcium binding protein, SDF-4, stromal cell derived factor 4 | |
| Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected form the middle region of SDF4. Peptide sequence KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| B1AME6 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51150 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction