missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SDHC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37905-100ul
This item is not returnable.
View return policy
Description
SDHC Polyclonal antibody specifically detects SDHC in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| SDHC | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Integral membrane protein CII-3, mitochondrial, PGL3, QPs1, QPs-1, SDH3, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa, succinate-ubiquinone oxidoreducatase cytochrome B large subunit | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1).,, Sequence:, MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL | |
| 100 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6391 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion