missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SDHD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00
Specifications
| Antigen | SDHD |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SDHD Polyclonal specifically detects SDHD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SDHD | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O14521 | |
| 6392 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CBT1, CII-4, CybS, PGL, PGL1, QPs3, SDH4, succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, Succinate dehydrogenase complex subunit D, succinate dehydrogenase complex, subunit D, integral membrane protein, succinate dehydrogenase ubiquinone cytochrome B small subunit, Succinate-ubiquinone oxidoreductase cytochrome b small subunit, Succinate-ubiquinone reductase membrane anchor subunit | |
| SDHD | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title