missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ SECTM1 Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA579967
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HEPA whole cell.
This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Specifications
| SECTM1 | |
| Polyclonal | |
| Unconjugated | |
| Sectm1b | |
| 1810003C24Rik; K12; Protein K-12; secreted and transmembrane 1; secreted and transmembrane 1B; secreted and transmembrane protein 1; secreted and transmembrane protein 1b; SECTM1; Sectm1b; type 1a transmembrane protein | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 58210 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| Q9JL59 | |
| Sectm1b | |
| A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK). | |
| 100 μg | |
| Primary | |
| Mouse | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction