missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ SEMA3B (Human) Recombinant Protein

Abnova™ SEMA3B (Human) Recombinant Protein

Product Code. 16142172
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16142172

Brand: Abnova™ H00007869P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Human SEMA3B full-length ORF (BAC03823.1, 1 a.a. - 132 a.a.) recombinant protein with GST tag at N-terminal.

  • Sequence: MYNSVLPTGGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTSMQISSKRAVPAARRKEWRPQHVVLRRLVSSRAAGTQGVRRGGQQRLSGV

Specifications

Accession Number BAC03823.1
Gene ID (Entrez) 7869
Name sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 10 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias FLJ34863, LUCA-1, SEMA5, SEMAA, SemA, semaV
Gene Symbol SEMA3B
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less

Safety and Handling

compliance-icons
Product Identifier
  • SEMA3B (Human) Recombinant Protein (P01)
 Signal Word
  • Warning
 Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2
 Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.
 Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash hands thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P304+P340-IF INHALED: Remove person to fresh air and keep comfortable for breathing.
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
 Supplemental information
  • MIXTURE LIST-Contains : tris-HCl, reduced glutathione
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.