missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Semaphorin 6D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69274
This item is not returnable.
View return policy
Description
Semaphorin 6D Polyclonal specifically detects Semaphorin 6D in Human samples. It is validated for Western Blot.
Specifications
| Semaphorin 6D | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KIAA1479FLJ11598, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D, semaphorin-6D | |
| Rabbit | |
| 65 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| A6NM95 | |
| SEMA6D | |
| Synthetic peptides corresponding to SEMA6D(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D) The peptide sequence was selected from the N terminal of SEMA6D. Peptide sequence KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 80031 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction