missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SENP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88919-25ul
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
SENP2 Polyclonal antibody specifically detects SENP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Tekniske data
| SENP2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AXAM2Axam2, DKFZp762A2316, EC 3.4.22, EC 3.4.22.68, KIAA1331sentrin-specific protease 2, Sentrin/SUMO-specific protease SENP2, Smt3ip2, SMT3IP2EC 3.4.22.-, SMT3-specific isopeptidase 2, SUMO1/sentrin/SMT3 specific peptidase 2, SUMO1/sentrin/SMT3 specific protease 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 59343 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion