missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35749-100ul
This item is not returnable.
View return policy
Description
Septin-1 Polyclonal antibody specifically detects Septin-1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| Septin-1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| DIFF6SEP1, differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase), LARP, Peanut-like protein 3, PNUTL3MGC20394, septin 1, septin-1, Serologically defined breast cancer antigen NY-BR-24 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human Septin-1 (NP_443070.5).,, Sequence:, IPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPM | |
| 100 μL | |
| Cell Cycle and Replication | |
| 1731 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?