missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERCA2 ATPase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59203
This item is not returnable.
View return policy
Description
SERCA2 ATPase Polyclonal antibody specifically detects SERCA2 ATPase in Human, Mouse, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications
| SERCA2 ATPase | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2 | |
| Rabbit | |
| 115 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| P16615 | |
| ATP2A2 | |
| Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. | |
| Affinity purified | |
| RUO | |
| 488 | |
| Human, Mouse, Monkey, Bovine, Canine, Equine, Guinea Pig, Rabbit, Rhesus Macaque, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction