missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SETD4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94376-0.1ml
This item is not returnable.
View return policy
Description
SETD4 Polyclonal antibody specifically detects SETD4 in Human, Mouse samples. It is validated for Western Blot
Specifications
| SETD4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human SETD4 (NP_001007260). YLRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR | |
| 0.1 mL | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 54093 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction