missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SETD5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 684.00
Specifications
| Antigen | SETD5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18154289
|
Novus Biologicals
NBP2-38257 |
0.1 mL |
€ 684.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694376
|
Novus Biologicals
NBP2-38257-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SETD5 Polyclonal specifically detects SETD5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| SETD5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9C0A6 | |
| 55209 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686J18276, FLJ10707, KIAA1757, SET domain containing 5, SET domain-containing protein 5 | |
| SETD5 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title